PNC-27 (5mg) – Product Description
PNC-27 (5mg) is a synthetic research peptide that has gained attention in experimental oncology studies for its unique interaction with HDM-2 proteins expressed on certain cancer cell membranes. It is a chimeric peptide derived from a p53 tumor suppressor sequence combined with a membrane-penetrating domain.
In laboratory settings, PNC-27 has been investigated for its ability to selectively target HDM-2-positive cells and induce membrane disruption in controlled in vitro and preclinical models. Researchers utilize this peptide to explore cancer cell biology, peptide–cell interactions, and tumor-specific signaling pathways.
This product is supplied as a high-purity lyophilized powder and is intended strictly for scientific and educational research purposes only. It is not approved for human or veterinary use, and there are currently no established clinical studies supporting therapeutic applications in humans.
Product Specifications
- Product Name: PNC-27
- Strength: 5mg
- Form: Lyophilized Powder
- Purity: ≥99% (HPLC Tested)
- Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
- Molecular Formula: C₁₈₈H₂₉₃N₅₃O₄₄S
- Molecular Weight: 4031.7 g/mol
- Storage: Store at 2–8°C (Long-term: -20°C)
- Grade: Research Grade
Research Applications
- Oncology Research
- Cancer Cell Model Studies
- HDM-2 Interaction Studies
- Peptide–Cell Interaction Research
- Membrane Biology Investigations
- Experimental Mechanistic Assays
Reviews
There are no reviews yet.